Importación y comercialización de insumos para diagnóstico e investigación
Inicio · Productos · C5a, Mouse, Recombinant

C5a, Mouse, Recombinant

Código: HC1101-50UG

Hycult Biotech

Descripción

Producto del catálogo Hycult Biotech. Referencia del fabricante: HC1101-50UG.

Complement fragment C5a is a 74-residu glycopolypeptide which is generated by proteolytic cleavage of the complement factor C5 in the course of complement activation. C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. In addition to its proinflammatory effects, C5a has been shown to protect cells against toxic insult and to stimulate proliferation in neurons and hepatocytes, suggesting a wider role for C5a in homeostasis. C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg, the first stage in deactivation of anaphylatoxin activity. The C5a desArg form has a different spectrum of bioactivity to intact C5a. Recombinant mouse C5a is His-Tagged and has the following amino acid sequence: MRGSHHHHHHGSDYDIPTTENLYFQGGSNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIAFNECCTIANKIRKESPHKPVQLGR.

The molecular weight of the protein is 12 kg/mol.

  • Reactividad / especie: Mouse

Solicítenos una cotización indicando el código. Ficha técnica completa disponible en el fabricante.

Especificaciones

Reactividad / especie Mouse
Tamaño 50 µg
Formulación Lyophilized product in 0.005% Tween 80, 2mM reduced L-glutathion, 0.2mM oxidized L-glutathion and 0.1M Tris-Cl buffer, pH 8.0, containing at least 50 μg murine C5a. The exact amount is indicated on the label. Reconstitute the vial by pipetting 0.5 ml distilled or de-ionised water (Caution: vial is under vacuum).
Almacenamiento Lyophilized product should be stored at 4°C. Store stock solution after reconstitution in aliquots at -20°C. Repeated freeze and thaw cycles cause loss of activity. Under recommended storage conditions, product is stable for one year.
Área de biología Infectious diseases, Nephrology, Neurological disorders

O envíenos el formulario de contacto →

Productos relacionados

Hycult Biotech Fabricante ↗

Alpha-1-antitrypsin, Human, pAb

Cód. HP9063

Producto del catálogo Hycult Biotech. Referencia del fabricante: HP9063. The goat polyclonal antibody recognizes human alpha-1-antitrypsin. This protein is a member of the serine protease inhibitor…

Ver ficha
Hycult Biotech Fabricante ↗

Beta-defensin 1, Human, pAb

Cód. HP9059

Producto del catálogo Hycult Biotech. Referencia del fabricante: HP9059. Antimicrobial proteins (AMP) are a fundamental element of the primary response against pathogens. AMP’s are small endogenous…

Ver ficha
Hycult Biotech Fabricante ↗

FHR4, Human, pAb

Cód. HP9058

Producto del catálogo Hycult Biotech. Referencia del fabricante: HP9058. Polyclonal antibody HP9058 recognizes human complement factor H related protein 4 (FHR4). The complement system is the…

Ver ficha
Hycult Biotech Fabricante ↗

Beta-defensin 2, Human, pAb

Cód. HP9057

Producto del catálogo Hycult Biotech. Referencia del fabricante: HP9057. The polyclonal antibody recognizes human beta-defensin 2 (hBD-2). hBD-2 is a cystein-rich cationic 41 amino acid antimicrobial…

Ver ficha